Question: What Are Some Good Cleaning Business Names?

What is another word for cleaning service?

What is another word for cleaning service?cleaning womanhousemaidhousekeepermaidmaidservantdailycharwomanhousecleanercleaning ladydaily woman78 more rows.

What are clean words?

Clean – thesaurusclean. adjective. not dirty.sterile. adjective. completely clean, with no bacteria.immaculate. adjective. so clean and tidy that there is no dirt.hygienic. adjective. clean and not likely to cause illness or disease.spotless. adjective. extremely clean.pristine. adjective. … polished. adjective. … fresh. adjective.More items…

What colors are best for a cleaning business?

1. The colors you choose send a strong message. White signals cleanliness and is a popular choice, although clearly no logo can be all white. Blue is associated with water and purity, and green has ties to nature and might be a good choice for a cleaning company that uses natural products.

Should a cleaning business be an LLC?

While you could operate your cleaning business as a sole proprietorship or partnership, you should consider using a legal form that protects you from personal liability, such as a corporation or a limited liability company.

Is it worth starting a cleaning business?

However, it is definitely worth it, according to these advantages: Low costs to start — Opening the doors to your cleaning business requires minimal start-up costs. … This means that as a cleaning business owner, you don’t need to rent or buy premises, buy a company vehicle or pay utility bills.

What’s a catchy name?

While other monikers can have depth and meaning, “catchy” names are designed to stay firmly within the mind of your target customer, no matter how many opposing titles they might see. These are the titles that are inherently memorable. Some of the best names even become synonymous with the thing they represent.

How do I start my own cleaning business from scratch?

How to Start a Cleaning Business in 7 StepsStep 1: Fund your cleaning business. … Step 2: Choose your market. … Step 3: Find your specialty—and stick to it. … Step 4: Plan your cleaning business budget. … Step 5: Register your cleaning business. … Step 6: Find and maintain clients. … Step 7: Invest in advertising and expanding.

What is a cleaning person called?

A janitor (American English, Scottish English), custodian, porter, cleaner or caretaker is a person who cleans and maintains buildings such as hospitals, schools, and residential accommodation. Janitors’ primary responsibility is as a cleaner. … In some cases, they will also carry out maintenance and security duties.

How do I come up with a cute business name?

How to come up with a business nameUse acronyms.Create mash-ups.Get inspiration from mythology and literature.Use foreign words.Use your own name.Take a look at a map.Mix things up.Partner with another company.More items…

What should you use to clean business cards?

Company name, address, telephone number, e-mail address, website, and any social media handles should all appear somewhere on the card. A great design structure is to include all of that information in relevant colors and fonts on one side of the card while putting your company logo and branding on the other side.

How do I find cleaning clients?

In order to help you get more clients for your cleaning business, we are listing our list of tips.Build an email list. Email marketing is not dead. … Postal mail campaign. … Paid advertising. … Display advertising. … Local promotions. … Irresistible offers and bonuses. … Recurring jobs. … Referrals.More items…•

What is the politically correct term for cleaning lady?

Housekeeper. But it’s not as funny as Consuela. A maid.

What materials do I need to start a cleaning business?

Chapter 3: What Equipment & Resources Do I Need to Start My Cleaning Business?Sponges and scourers.Yellow dusters/microfibre cloths.Glass polishing cloths.Cleaning brushes.A mop and bucket.A dustpan and brush.Protective gloves.A plastic caddy to carry the essentials.

How much does it cost to start your own cleaning company?

Take into account the business license and permit fees, business registration fees, insurance, cleaning products, and any equipment required, marketing and advertising costs, and labor costs, e.g., employee wages. In some cases, experts estimate, you can start a cleaning business for as low as $2000 initial cost.

Where can I buy cheap business cards?

Vistaprint offers inexpensive business cards that come in your choice of shape, paper stock, and finish. Choose from our selection of designs to suite your business needs. It’s time to make an impression with a professional card at a cheaper price!

How do I make my cleaning business stand out?

6 Ways to Make Your Cleaning Company Stand Out From the CompetitionPricing and Value. Of course, the most obvious way to stand out from other companies is in your pricing. … Customer Service. … Find Your Niche. … Invest in Your Employees. … Invest in Yourself. … Ask for and Listen to Feedback.

How do I pick a catchy business name?

Here are 12 helpful suggestions on how to come up with a winning name for your business:Avoid hard-to-spell names. … Don’t pick a name that could be limiting as your business grows. … Conduct a thorough Internet search. … Get the .com domain name. … Use a name that conveys some meaning. … Conduct a trademark search.More items…•

How do I name my small business?

10 Tips for Naming Your Startup or Small BusinessThink about what you want your business name to convey. … Brainstorm to identify name possibilities. … Keep the name short, simple, and easy to write and remember. … Avoid names that are too narrow or too literal. … Avoid decisions by a committee but do “test” your company name with others. … Avoid plain words.More items…